Description
SDF-1α (CXCL12) labelled 15N and 13C for NMR (50 µg) [HM-161]
SDF-1α for Mass Spectrometry is the 8 kDa protein labelled with isotope 15N and 13C .This protein is suitable for NMR studies.This product corresponds to the human sequence and is produced in E.coli.SDF-1α we provide is the natural protein, with no tags or additional amino acids.
It has the sequence:
MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Molecular Mass: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) consists of 69 amino acid residues and has a calculated molecular mass of approximately 8 kDAPurity: The purified protein is >95% homogeneous (electrophoresis and mass spectrometry). It contains no nucleic acids.Endotoxin Level: The purified protein is free from LPS (Cambrex Limulus Amoebocyte Assay QCL-1000, <0.1 ng LPS per mg protein).Buffer: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) is lyophilized from DPBS without Ca and Mg.Storage: 2-8°C when lyophilized. The protein once reconstituted with water can be stored frozen (-20°C). Avoid repeated freezing and thawing.
This product is intended for research only, and cannot be used on humans.
Reviews
There are no reviews yet.